PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00014217-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 688aa    MW: 77899.2 Da    PI: 7.5907
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00014217-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.64.2e-2893180191
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++     +r+ ++++t+Cka+++vkk++dgkw+++++++eHnHe
  SMil_00014217-RA_Salv  93 SFYQEYAKSMGFTTSIKNSRRSKKTKEFIDAKFACSRYGVTPESESG---VSRRPSVKKTDCKASMHVKKKRDGKWYIHEFVKEHNHE 177
                            5****************************************999887...77778899****************************** PP

                   FAR1  89 lap 91 
                            l p
  SMil_00014217-RA_Salv 178 LLP 180
                            975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-2593180IPR004330FAR1 DNA binding domain
PfamPF044347.9E-8417450IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.027417453IPR007527Zinc finger, SWIM-type
SMARTSM005751.2E-8428455IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MLNLNHRLIV VLKFNQHWKQ LFRETIDAMV DFEDNVGGGE QSLALNVVDI VDVSKSREGQ  60
VSSSSRRDVV GIEGDSFEPH DGIEFDSHEA AYSFYQEYAK SMGFTTSIKN SRRSKKTKEF  120
IDAKFACSRY GVTPESESGV SRRPSVKKTD CKASMHVKKK RDGKWYIHEF VKEHNHELLP  180
ALAYHFRIHR NVKLAEKSNI DILYAIPDRG IGRSRMPSQE GKEYGGSATF RVDDCEKMRI  240
LWLHGMKESQ SIPSQYILKR WMKDAKGKQL LVEGTERIQN RIQRYNDLCK RAIGLGEEGS  300
LSEENYNIAC RALVEALKSC VHINNENPVE CSSNTAGLRF TEEEDLLLPP AKTIKKKNAN  360
KKRKTQPEPE AVAIDTQDSL HQMIEVLGVV GCHPKKEKEY GGSTTFRVDD CEKNENFVVT  420
WNEGKSEVSC SCLMFEYKGF LCRHAMIVLQ ICGLSSIPSQ YILKRWMKDA KGKQLLVEGT  480
ERIQNRIQRY NDLCKRAIGL GEEGSLSEEN YNIACRALVE ALKSCVHINN ENPVECSSNT  540
AGLRFTEEED LLLPPAKTIK KKNANKKRKT QPEPEAVAID TQDSLHQMEH LSSEEIPVNG  600
YYGSQQHVHG LLNLMEPPND GFYVGHQTMQ GLGQLHSLAS SHDSFYGAHQ QSMPALGHLD  660
FRQPTFTYGM QDDQSVRPAQ LHGTARHA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085456.11e-162PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_011085457.11e-162PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
SwissprotQ9SWG31e-103FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A022RW201e-160A0A022RW20_ERYGU; Uncharacterized protein
STRINGSolyc08g060840.1.11e-128(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.16e-92FAR1 family protein